TEX264 Rabbit Polyclonal Antibody

• Catalog Number: orb325322
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TEX264
• Target: TEX264
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TEX264
• Protein Sequence: Synthetic peptide located within the following region: SIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYV
• UniProt ID: Q9Y6I9
• MW: 34kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti DKFZp451H0417 antibody, anti FLJ13935 antibod
• Research Area: Cell Biology, Signal Transduction
• Note: For research use only
• NCBI: NP_057010

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The peptide is present in isoforms of 44 kDa, 38 kDa, 34 kDa and 27 kDa. The protein may be phosphorylated.

Rabbit Anti-TEX264 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Testis, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-TEX264 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: COLO205 cell lysate.