You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1977726 |
---|---|
Category | Proteins |
Description | May be involved in cell proliferation and cell motility. Tetraspanin-7/TSPAN7 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 15.6 kDa and the accession number is P41732. |
Tag | N-6xHis |
Purity | 98.00% |
Protein Sequence | RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM |
UniProt ID | P41732 |
MW | 15.6 kDa (predicted) |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expression System | E. coli |
Biological Origin | Human |
Biological Activity | May be involved in cell proliferation and cell motility. Tetraspanin-7/TSPAN7 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 15.6 kDa and the accession number is P41732. |
Expression Region | 113-213 aa |
Storage | -20°C |
Note | For research use only |