You have no items in your shopping cart.
Cart summary
Tetraspanin-7/TSPAN7 Protein, Human, Recombinant (E. coli, His)
Catalog Number: orb1977726
| Catalog Number | orb1977726 |
|---|---|
| Category | Proteins |
| Description | May be involved in cell proliferation and cell motility. Tetraspanin-7/TSPAN7 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 15.6 kDa and the accession number is P41732. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 15.6 kDa (predicted) |
| UniProt ID | P41732 |
| Protein Sequence | RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | May be involved in cell proliferation and cell motility. Tetraspanin-7/TSPAN7 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 15.6 kDa and the accession number is P41732. |
| Expression Region | 113-213 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
