TES-26 Protein, Toxocara canis, Recombinant (His)

• Catalog Number: orb1976292
• Category: Proteins
• Description: Binds phosphatidylethanolamine. TES-26 Protein, Toxocara canis, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 27.9 kDa and the accession number is P54190.
• Tag: N-6xHis
• Purity: 98.00%
• Protein Sequence: QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA
• UniProt ID: P54190
• MW: 27.9 kDa (predicted)
• Application notes: A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
• Expression System: P. pastoris (Yeast)
• Biological Origin: Toxocara canis
• Biological Activity: Binds phosphatidylethanolamine. TES-26 Protein, Toxocara canis, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 27.9 kDa and the accession number is P54190.
• Expression Region: 22-262 aa
• Storage: -20°C
• Note: For research use only