You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1976292 |
---|---|
Category | Proteins |
Description | Binds phosphatidylethanolamine. TES-26 Protein, Toxocara canis, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 27.9 kDa and the accession number is P54190. |
Tag | N-6xHis |
Purity | 98.00% |
Protein Sequence | QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA |
UniProt ID | P54190 |
MW | 27.9 kDa (predicted) |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expression System | P. pastoris (Yeast) |
Biological Origin | Toxocara canis |
Biological Activity | Binds phosphatidylethanolamine. TES-26 Protein, Toxocara canis, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 27.9 kDa and the accession number is P54190. |
Expression Region | 22-262 aa |
Storage | -20°C |
Note | For research use only |
98.00% | |
41.9 kDa (predicted) |