TENT2 Rabbit Polyclonal Antibody

SKU: orb580648

Description

Rabbit polyclonal antibody to TENT2

Research Area

Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PAPD4
• Target: TENT2
• Protein Sequence: Synthetic peptide located within the following region: GRKRLSDEKNLPLDGKRQRFHSPHQEPTVVNQIVPLSGERRYSMPPLFHT
• Molecular Weight: 56kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

APD4, GLD2, TUT2, PAPD4

Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.

WB Suggested Anti-PAPD4 Antibody Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.

Quick Database Links

Gene Symbol

TENT2

UniProt

Q6PIY7

RefSeq (Protein):NP_776158