GPSN2 Rabbit Polyclonal Antibody

• Catalog Number: orb580402
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GPSN2
• Target: TECR
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GPSN2
• Protein Sequence: Synthetic peptide located within the following region: PFIYGHKYDFTSSRHTVVHLACICHSFHYIKRLLETLFVHRFSHGTMPLR
• UniProt ID: Q9NZ01
• MW: 36kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: SC2, TER, GPSN2, MRT14
• Research Area: Cell Biology
• Note: For research use only
• NCBI: NP_612510
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human RPMI 8226 Whole Cell, Antibody dilution: 3 ug/ml.

WB Suggested Anti-GPSN2 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.