You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
TCP10L Rabbit Polyclonal Antibody
Catalog Number: orb325239
| Catalog Number | orb325239 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to TCP10L |
| Target | TCP10L |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TCP10L |
| Protein Sequence | Synthetic peptide located within the following region: ASPHAGQESHTLALEPAFGKISPLSADEETIPKYAGHKNQSATLLGQRSS |
| UniProt ID | Q8TDR4 |
| MW | 24kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti PRED77 antibody, anti TCP10A-2 antibody, anti Read more... |
| Research Area | Disease Biomarkers |
| Note | For research use only |
| NCBI | NP_653260 |
| Expiration Date | 12 months from date of receipt. |
Human Heart
WB Suggested Anti-TCP10L Antibody Titration: 1.25 ug/mL, Positive Control: HepG2 cell lysate.
- Item 1 of 2
TCP10L Antibody [orb631786]
ELISA, IF, IHC, WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
100 μg, 50 μg 
