You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb334558 |
---|---|
Category | Antibodies |
Description | TCP1 alpha Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ICC, IF, IHC, WB |
Predicted Reactivity | Bovine |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 5μg/ml, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 60344 MW |
UniProt ID | P17987 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | T-complex protein 1 subunit alpha;TCP-1-alpha;CCT- Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of TCP1 using anti-TCP1 antibody.Lane 1:Rat Brain Tissue;2:Rat Testis Tissue;3:Mouse Spleen Tissue;4:Mouse Thymus Tissue;5:HELA Cell;6:MCF-7 Cell.
IF analysis of TCP1 using anti-TCP1 antibody.TCP1 was detected in immunocytochemical section of CACO-2 cells.
IHC analysis of TCP1 using anti-TCP1 antibody. TCP1 was detected in a paraffin-embedded section of human testis tissue.
IHC analysis of TCP1 using anti-TCP1 antibody. TCP1 was detected in a paraffin-embedded section of mouse testis tissue.
IHC analysis of TCP1 using anti-TCP1 antibody. TCP1 was detected in a paraffin-embedded section of rat ovary tissue.
FC, ICC, IF, IHC, WB | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating