TCP1 alpha Antibody

• Catalog Number: orb334558
• Category: Antibodies
• Description: TCP1 alpha Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ICC, IF, IHC, WB
• Predicted Reactivity: Bovine
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 5μg/ml, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 60344 MW
• UniProt ID: P17987
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: T-complex protein 1 subunit alpha;TCP-1-alpha;CCT-
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of TCP1 using anti-TCP1 antibody.Lane 1:Rat Brain Tissue;2:Rat Testis Tissue;3:Mouse Spleen Tissue;4:Mouse Thymus Tissue;5:HELA Cell;6:MCF-7 Cell.

IF analysis of TCP1 using anti-TCP1 antibody.TCP1 was detected in immunocytochemical section of CACO-2 cells.

IHC analysis of TCP1 using anti-TCP1 antibody. TCP1 was detected in a paraffin-embedded section of human testis tissue.

IHC analysis of TCP1 using anti-TCP1 antibody. TCP1 was detected in a paraffin-embedded section of mouse testis tissue.

IHC analysis of TCP1 using anti-TCP1 antibody. TCP1 was detected in a paraffin-embedded section of rat ovary tissue.