TCP1 alpha Antibody (monoclonal, 2E7)

• Catalog Number: orb421123
• Category: Antibodies
• Description: TCP1 alpha Antibody (monoclonal, 2E7)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2E7
• Tested applications: FC, ICC, IF, IHC, WB
• Reactivity: Human
• Isotype: Mouse IgG1
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 alpha (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml Immunocytochemistry/Immunofluorescence, 2μg/ml Flow Cytometry, 1-3μg/1x106 cells
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 60 kDa
• UniProt ID: P17987
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: T-complex protein 1 subunit alpha; TCP-1-alpha; CC
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of HepG2 cells using anti-TCP1 alpha antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of TCP1 alpha using anti-TCP1 alpha antibody.Lane 1:human HeLa cell;2:human MCF-7 cell;3:human COLO-320 cell;4:human HepG2 cell;5:human A431 cell;6:human HT1080 cell.

IF analysis of TCP1 alpha using anti-TCP1 alpha antibody. TCP1 alpha was detected in immunocytochemical section of MCF7 cells.

IHC analysis of TCP1 alpha using anti-TCP1 alpha antibody.TCP1 alpha was detected in paraffin-embedded section of human lung cancer tissue.

IHC analysis of TCP1 alpha using anti-TCP1 alpha antibody.TCP1 alpha was detected in paraffin-embedded section of human placenta tissue.