You have no items in your shopping cart.
Cart summary
Item 1 of 1
TCL1B Rabbit Polyclonal Antibody
Catalog Number: orb326525
Product Properties
| Catalog Number | orb326525 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to TCL1B |
| Target | TCL1B |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Protein Sequence | Synthetic peptide located within the following region: NPSRREWARASQGSRYEPSITVHLWQMAVHTRELLSSGQMPFSQLPAVWQ |
| UniProt ID | O95988 |
| MW | 15kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti TML1 antibody |
| Research Area | Cancer Biology, Cell Biology, Epigenetics & Chroma Read more... |
| Note | For research use only |
| NCBI | NP_004909 |
Images
Antibody Dilution: 1.0 ug/mL, Sample Type: MCF7 cell lysate.
Similar Products
TCL1B polyclonal antibody [orb647850]
IF, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl
Reviews
TCL1B Rabbit Polyclonal Antibody (orb326525)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review