TCF3 monoclonal antibody (M01), clone 5G2

• Catalog Number: orb2292086
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant TCF3.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2b Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: TCF3 (NP_003191, 545 a.a. ~ 654 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: EREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM
• Tested applications: ELISA, WB
• Clone Number: 5G2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_003191

Detection limit for recombinant GST tagged TCF3 is approximately 0.03 ng/ml as a capture antibody.

TCF3 monoclonal antibody (M01), clone 5G2 Western Blot analysis of TCF3 expression in Hela S3 NE.

Western Blot detection against Immunogen (37.84 KDa).