Tcea2 Rabbit Polyclonal Antibody

SKU: orb324674

Description

Rabbit polyclonal antibody to Tcea2

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology, Protein Biochemistry

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Equine, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse Tcea2
• Target: Tcea2
• Protein Sequence: Synthetic peptide located within the following region: KDASRTTDLSCKKPDPPRTPSTPRITTFPQVPITCDAVRNKCREMLTLAL
• Molecular Weight: 34
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti AI326274 antibody, anti S-II-T1 antibody, anti SII-T1 antibody, anti Tceat antibody

WB Suggested Anti-Tcea2 Antibody Titration: 0.2-1 ug/mL, Positive Control: Mouse Uterus.

Quick Database Links

Gene Symbol

Tcea2

UniProt

Q9QVN7

RefSeq (Protein):NP_033352