TBX5 Rabbit Polyclonal Antibody

• Catalog Number: orb574649
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TBX5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBX5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 58 kDa
• Target: TBX5
• UniProt ID: Q99593
• Protein Sequence: Synthetic peptide located within the following region: NSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKIT
• NCBI: NP_000183
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HOS
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Several isoforms in the region of 58-60 kDa contain this peptide sequence.

Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 2 ug/ml.

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 3 ug/ml.

Immunohistochemistry with Human Brain, cortex tissue at an antibody concentration of 5.0 ug/ml using anti-TBX5 antibody (orb574649).