You have no items in your shopping cart.
Cart summary
Item 1 of 1
TBX22 Rabbit Polyclonal Antibody
Catalog Number: orb574363
Product Properties
| Catalog Number | orb574363 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to TBX22 |
| Target | TBX22 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Equine, Mouse, Porcine, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TBX22 |
| Protein Sequence | Synthetic peptide located within the following region: QSMHKYKPRVHVIEQGSSVDLSQIQSLPTEGVKTFSFKETEFTTVTAYQN |
| UniProt ID | Q9Y458 |
| MW | 58kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | CPX, CLPA, TBXX, ABERS, dJ795G23.1 |
| Research Area | Epigenetics & Chromatin, Molecular Biology, Stem C Read more... |
| Note | For research use only |
| NCBI | NP_058650 |
Images
WB Suggested Anti-TBX22 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.
Similar Products
- Item 1 of 2
- Item 1 of 2
TBX22 Rabbit Polyclonal Antibody [orb499654]
IF, IHC-Fr, IHC-P, WB
Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 1
- Item 1 of 1
- Item 1 of 1
Reviews
TBX22 Rabbit Polyclonal Antibody (orb574363)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review