TBX19 Rabbit Polyclonal Antibody

SKU: orb324416

Description

TBX19 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of TBX19. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human TBX19. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TBX19
• Target: TBX19
• Protein Sequence: Synthetic peptide located within the following region: IKYNPFAKAFLDAKERNHLRDVPEAISESQHVTYSHLGGWIFSNPDGVCT
• Molecular Weight: 48kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti FLJ26302 antibody, anti FLJ34543 antibody, anti TBS 19 antibody, anti TBS19 antibody, anti TPIT antibody, anti dJ747L4.1 antibody

Quick Database Links

Gene Symbol

TBX19

UniProt

O60806

RefSeq (Protein):NP_005140