TBX19 Rabbit Polyclonal Antibody

• Catalog Number: orb324415
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TBX19
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBX19
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 48kDa
• Target: TBX19
• UniProt ID: O60806
• Protein Sequence: Synthetic peptide located within the following region: KPSDGTVSHLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTN
• NCBI: NP_005140
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti TPIT antibody, anti TBS19 antibody, anti dJ74
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human kidney

Human Liver

WB Suggested Anti-TBX19 Antibody Titration: 1.0-1.5 ug/mL, Positive Control: Jurkat cell lysate.