You have no items in your shopping cart.
Cart summary
Item 1 of 1
TRF3 Rabbit Polyclonal Antibody
Catalog Number: orb324726
Product Properties
| Catalog Number | orb324726 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to Tbpl2 |
| Target | Tbpl2 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Mouse |
| Predicted Reactivity | Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse TRF3 |
| Protein Sequence | Synthetic peptide located within the following region: FHPHLGGVKKASTDFSSVDLSFLPDELTQENRDQTVTGNKLASEESCRTR |
| UniProt ID | Q6SJ95 |
| MW | 39kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti Trf3 antibody, anti Gm348 antibody, anti RP23 Read more... |
| Research Area | Epigenetics & Chromatin |
| Note | For research use only |
| NCBI | NP_951014 |
Images
WB Suggested Anti-TRF3 Antibody Titration: 5.0 ug/mL, ELISA Titer: 1:1562500, Positive Control: SP2/0 cell lysate.
Similar Products
- Item 1 of 4
- Item 1 of 1
- Item 1 of 1
- Item 1 of 2
TBPL2 polyclonal antibody [orb646234]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl
Reviews
TRF3 Rabbit Polyclonal Antibody (orb324726)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review