TBCB purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2294401
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human TBCB protein.
• Clonality: Polyclonal
• Species/Host: Mouse
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: TBCB (AAH05969, 1 a.a. ~ 244 a.a) full-length human protein.
• Protein Sequence: MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH05969

TBCB MaxPab polyclonal antibody. Western Blot analysis of TBCB expression in HeLa.

TBCB MaxPab polyclonal antibody. Western Blot analysis of TBCB expression in K-562.

Western Blot analysis of TBCB expression in transfected 293T cell line by TBCB MaxPab polyclonal antibody. Lane 1: CKAP1 transfected lysate(26.84 KDa). Lane 2: Non-transfected lysate.