You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294401 |
---|---|
Category | Antibodies |
Description | Mouse polyclonal antibody raised against a full-length human TBCB protein. |
Clonality | Polyclonal |
Species/Host | Mouse |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | TBCB (AAH05969, 1 a.a. ~ 244 a.a) full-length human protein. |
Protein Sequence | MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH05969 |
TBCB MaxPab polyclonal antibody. Western Blot analysis of TBCB expression in HeLa.
TBCB MaxPab polyclonal antibody. Western Blot analysis of TBCB expression in K-562.
Western Blot analysis of TBCB expression in transfected 293T cell line by TBCB MaxPab polyclonal antibody. Lane 1: CKAP1 transfected lysate(26.84 KDa). Lane 2: Non-transfected lysate.