TBCB purified MaxPab mouse polyclonal antibody (B02P)

• Catalog Number: orb2294400
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human TBCB protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: TBCB (NP_001272.2, 1 a.a. ~ 244 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI
• NCBI: NP_001272.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CKAP1 MaxPab polyclonal antibody. Western Blot analysis of CKAP1 expression in human spleen.

Western Blot analysis of TBCB expression in transfected 293T cell line by TBCB MaxPab polyclonal antibody. Lane 1: CKAP1 transfected lysate(26.84 KDa). Lane 2: Non-transfected lysate.