TBC1D7 Rabbit Polyclonal Antibody

• Catalog Number: orb326139
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TBC1D7
• Target: TBC1D7
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TBC1D7
• Protein Sequence: Synthetic peptide located within the following region: MYQLESGKLPRSPSFPLPKAFEQYLNLEDGRLLTHLRMCSAAPKLPYDLW
• UniProt ID: Q9P0N9
• MW: 27kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: TBC7, MGCPH, PIG51
• Research Area: Cell Biology, Stem Cell & Developmental Biology
• Note: For research use only

Sample Type: Fetal Brain lysates, Antibody Dilution: 1.0 ug/mL.