TBC1D24 Rabbit Polyclonal Antibody

• Catalog Number: orb326202
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TBC1D24
• Target: TBC1D24
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TBC1D24
• Protein Sequence: Synthetic peptide located within the following region: SDPADRLSPFLAARHFNLPSKTESMFMAGGSDCLIVGGGGGQALYIDGDL
• UniProt ID: Q9ULP9
• MW: 62kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti KIAA1171 antibody, anti MGC102885 antibody, a
• Research Area: Neuroscience
• Note: For research use only
• NCBI: NP_065756

Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 3 ug/mL.

Positive control (+): Human liver (LI), Negative control (-): Human Ovary (OV), Antibody concentration: 1 ug/mL.

WB Suggested Anti-TBC1D24 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Human kidney.