TBC1D22A Rabbit Polyclonal Antibody

SKU: orb578500

Description

TBC1D22A Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of TBC1D22A. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of Human TBC1D22A. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TBC1D22A
• Target: TBC1D22A
• Protein Sequence: Synthetic peptide located within the following region: TEIFERILFIWAIRHPASGYVQGINDLVTPFFVVFICEYIEAEEVDTVDV
• Molecular Weight: 48kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

C22orf4, HSC79E021

Quick Database Links

Gene Symbol

TBC1D22A

UniProt

Q8WUA7