TAGAP Rabbit Polyclonal Antibody

SKU: orb585240

Description

TAGAP Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting TAGAP. It is suitable for WB and is reactive with human samples. Predicted reactivity includes Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: TAGAP
• Protein Sequence: Synthetic peptide located within the following region: PRPNLLLLKHLVYVLHLISKNSEVNRMDSSNLAICIGPNMLTLENDQSLS
• Molecular Weight: 81kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

FKSG15, IDDM21, TAGAP1, ARHGAP47

WB Suggested Anti-TAGAP Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Liver.

Quick Database Links

Gene Symbol

TAGAP

UniProt

Q8N103

RefSeq (Protein):NP_473455