TAF1A Rabbit Polyclonal Antibody

• Catalog Number: orb592882
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TAF1A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TAF1A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 40kDa
• Target: TAF1A
• UniProt ID: Q9NWA1
• Protein Sequence: Synthetic peptide located within the following region: CEKAFVAGLLLGKGCRYFRYILKQDHQILGKKIKRMKRSVKKYSIVNPRL
• NCBI: NP_647603
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SL1, RAFI48, TAFI48, MGC:17061
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human Heart

WB Suggested Anti-TAF1A Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.