TAF10 Rabbit Polyclonal Antibody

• Catalog Number: orb573788
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TAF10
• Target: TAF10
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TAF10
• Protein Sequence: Synthetic peptide located within the following region: GFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRK
• UniProt ID: Q12962
• MW: 22kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: TAF2A, TAF2H, TAFII30
• Research Area: Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_006275

Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.

WB Suggested Anti-TAF10 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: THP-1 cell lysate.