MAP3K7IP2 Rabbit Polyclonal Antibody

• Catalog Number: orb324417
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TAB2
• Target: TAB2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAP3K7IP2
• Protein Sequence: Synthetic peptide located within the following region: QKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDLNFSDDSG
• UniProt ID: Q9NYJ8
• MW: 76kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti CHTD2 antibody, anti MAP3K7IP2 antibody
• Research Area: Epigenetics & Chromatin, Immunology & Inflammation
• Note: For research use only
• NCBI: NP_055908

Human Spermatophore

Human Stomach

WB Suggested Anti-MAP3K7IP2 Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2 cell lysate, TAB2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.