You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IF, WB |
|---|---|
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TAAR5 |
| Target | TAAR5 |
| Protein Sequence | Synthetic peptide located within the following region: TTLSKSLAGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITP |
| Molecular Weight | 38kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−TAAR5 Rabbit Polyclonal Antibody [orb584398]
IF, WB
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
Human, Mouse
Rabbit
Polyclonal
Unconjugated
100 μlTAAR5 rabbit pAb Antibody [orb770812]
ELISA, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μltrace amine associated receptor 5 Antibody [orb556503]
ICC, WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Immunofluorescence - dilution: 1.3 ug/ml.

WB Suggested Anti-TAAR5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: PANC1 cell lysate. TAAR5 is supported by BioGPS gene expression data to be expressed in PANC1.

WB Suggested Anti-TAAR5 antibody Titration: 1 ug/ml, Sample Type: Human OVCAR-3.
Documents Download
Request a Document
Protocol Information
TAAR5 Rabbit Polyclonal Antibody (orb584397)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review








