SYNGAP1 Rabbit Polyclonal Antibody

SKU: orb326496

Description

Rabbit polyclonal antibody to SYNGAP1

Research Area

Cell Biology, Immunology & Inflammation, Neuroscience, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: SYNGAP1
• Protein Sequence: Synthetic peptide located within the following region: EYKLKEYSKSMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQ
• Molecular Weight: 148kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti DKFZp761G1421 antibody, anti KIAA1938 antibody, anti MRD5 antibody, anti RASA1 antibody, anti RASA5 antibody, anti SYNGAP antibody

WB Suggested Anti-SYNGAP1 Antibody, Titration: 1.0 ug/mL, Positive Control: Fetal kidney.

Quick Database Links

Gene Symbol

SYNGAP1

UniProt

Q96PV0

RefSeq (Protein):NP_006763