SYNC Rabbit Polyclonal Antibody

• Catalog Number: orb585715
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SYNC
• Target: SYNC
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: MKEALRPLQAEARQLRLQNRNLEDQIALVRQKRDEEVQQYREQLEEMEER
• UniProt ID: Q9H7C4
• MW: 52kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: SYNC1, SYNCOILIN
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_001155180

Rabbit Anti-SYNC Antibody, Catalog Number: orb585715, Formalin Fixed Paraffin Embedded Tissue: Human Heart Tissue, Observed Staining: Cytoplasm in perinuclear, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-SYNC Antibody, Titration: 1.0 ug/ml, Positive Control: U937 Whole Cell.