SYNC Rabbit Polyclonal Antibody

SKU: orb585715

Description

Rabbit polyclonal antibody to SYNC

Research Area

Epigenetics

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: SYNC
• Protein Sequence: Synthetic peptide located within the following region: MKEALRPLQAEARQLRLQNRNLEDQIALVRQKRDEEVQQYREQLEEMEER
• Molecular Weight: 52kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

SYNC1, SYNCOILIN

Rabbit Anti-SYNC Antibody, Catalog Number: orb585715, Formalin Fixed Paraffin Embedded Tissue: Human Heart Tissue, Observed Staining: Cytoplasm in perinuclear, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-SYNC Antibody, Titration: 1.0 ug/ml, Positive Control: U937 Whole Cell.

Quick Database Links

Gene Symbol

SYNC

UniProt

Q9H7C4

RefSeq (Protein):NP_001155180