SWAP70 monoclonal antibody (M09A), clone 3H8

• Catalog Number: orb2291360
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant SWAP70.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3H8
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG2a Kappa
• Immunogen: SWAP70 (NP_055870, 378 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: QTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRELEDMYLKLQEALEDERQARQDEETVRKLQA
• NCBI: NP_055870
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In ascites fluid
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

SWAP70 monoclonal antibody (M09A), clone 3H8. Western Blot analysis of SWAP70 expression in human spleen.

SWAP70 monoclonal antibody (M09A), clone 3H8. Western Blot analysis of SWAP70 expression in NIH/3T3.

SWAP70 monoclonal antibody (M09A), clone 3H8. Western Blot analysis of SWAP70 expression in PC-12.

SWAP70 monoclonal antibody (M09A), clone 3H8. Western Blot analysis of SWAP70 expression in Raw 264.7.

Western Blot analysis of SWAP70 expression in transfected 293T cell line by SWAP70 monoclonal antibody (M09A), clone 3H8. Lane 1: SWAP70 transfected lysate(69 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (33.88 KDa).