SVSP Protein, Crotalus atrox, Recombinant (His)

• Catalog Number: orb1979462
• Category: Proteins
• Description: SVSP Protein, Crotalus atrox, Recombinant (His) is expressed in Yeast.
• Tag: N-6xHis
• Purity: 98.00%
• MW: 27.2 kDa (predicted)
• UniProt ID: Q8QHK2
• Protein Sequence: VVGGDECNINEHRSLVAIFNSTEFFCSGTLINQEWVVTAAHCDSTNFKMKLGVHSKKVPNEDEQTRNPKEKFFCPNKKKDDVLDKDIMLIKLDSPVSNSEHIAPLSLPSSPPSVGSVCHIMGWGSITPIEKTLPDVPYCANIKLLDDAVCQPPYPELPATSRTLCAGIPEGGKDTCGGDSGGPLICNGQFQGIVFYGAHPCGQALKPGVYTKVFDYNDWIQSIIAGNTAATCPP
• Expression System: P. pastoris (Yeast)
• Biological Origin: Crotalus atrox
• Biological Activity: SVSP Protein, Crotalus atrox, Recombinant (His) is expressed in Yeast.
• Expression Region: 25-258 aa
• Storage: -20°C
• Note: For research use only
• Application notes: Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
• Expiration Date: 6 months from date of receipt.