You have no items in your shopping cart.
Cart summary
SVSP Protein, Crotalus atrox, Recombinant (His & Myc)
Catalog Number: orb1979461
| Catalog Number | orb1979461 |
|---|---|
| Category | Proteins |
| Description | Snake venom serine protease that may act in the hemostasis system of the prey. SVSP Protein, Crotalus atrox, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 29.1 kDa and the accession number is Q8QHK2. |
| Tag | N-10xHis, C-Myc |
| Purity | 98.00% |
| MW | 29.1 kDa (predicted) |
| UniProt ID | Q8QHK2 |
| Protein Sequence | VVGGDECNINEHRSLVAIFNSTEFFCSGTLINQEWVVTAAHCDSTNFKMKLGVHSKKVPNEDEQTRNPKEKFFCPNKKKDDVLDKDIMLIKLDSPVSNSEHIAPLSLPSSPPSVGSVCHIMGWGSITPIEKTLPDVPYCANIKLLDDAVCQPPYPELPATSRTLCAGIPEGGKDTCGGDSGGPLICNGQFQGIVFYGAHPCGQALKPGVYTKVFDYNDWIQSIIAGNTAATCPP |
| Expression System | Baculovirus Insect Cells |
| Biological Origin | Crotalus atrox |
| Biological Activity | Snake venom serine protease that may act in the hemostasis system of the prey. SVSP Protein, Crotalus atrox, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 29.1 kDa and the accession number is Q8QHK2. |
| Expression Region | 25-258 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
