Sumo3 Rabbit Polyclonal Antibody

SKU: orb330452

Description

Rabbit polyclonal antibody to Sumo3

Research Area

Cell Biology, Molecular Biology, Protein Biochemistry, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Sumo3
• Target: Sumo3
• Protein Sequence: Synthetic peptide located within the following region: PKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMR
• Molecular Weight: 12kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti 2810014B19Rik antibody, anti AA409334 antibody, anti AW121497 antibody, anti AW536077 antibody, anti D10Ertd345e antibody, anti SMT3A antibody, anti SUMO-3 antibody, anti Smt3h1 antibody, anti Smt3B antibody

Sample: HEK293 cells (10 ug, 50 ug), Dilution: 1:1000.

Sumo3 Antibody - N-terminal region (orb330452) validated by WB using Mouse Heart lysate at 1 ug/mL.

Quick Database Links

Gene Symbol

Sumo3

UniProt

Q9Z172

RefSeq (Protein):NP_064313