SUMF1 Rabbit Polyclonal Antibody

• Catalog Number: orb331269
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SUMF1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SUMF1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 41 kDa
• Target: SUMF1
• UniProt ID: Q8NBK3
• Protein Sequence: Synthetic peptide located within the following region: SREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVT
• NCBI: NP_877437
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti AAPA3037 antibody, anti FGE antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 34 kDa.

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: PANC1 Whole cell lysates, Antibody dilution: 1.0 ug/ml.