SULT1B1 Rabbit Polyclonal Antibody

• Catalog Number: orb580514
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SULT1B1
• Target: SULT1B1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Porcine, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SULT1B1
• Protein Sequence: Synthetic peptide located within the following region: MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSG
• UniProt ID: O43704
• MW: 35kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ST1B1, ST1B2, SULT1B2
• Note: For research use only
• NCBI: NP_055280
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Stomach Tumor, Antibody dilution: 1 ug/ml.

Positive control (+): Human Stomach Tumor (T-ST), Negative control (-): Human Lung Tumor (T-LU), Antibody concentration: 3 ug/ml.

WB Suggested Anti-SULT1B1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human Intestine.