You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2052009 |
---|---|
Category | Proteins |
Description | SULT1A1 Recombinant Protein (Human) |
Tag | N-terminal GST-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 61.1 kDa |
UniProt ID | P50225 |
Protein Sequence | MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL |
Source | E.coli |
NCBI | NP_001046 |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | aryl sulfotransferase 1;HAST1/HAST2;Phenol sulfotr Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
61.1 kDa | |
E.coli |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
E. coli |
> 95% by SDS-PAGE. | |
KMP1037, Recombinant Human SULT1A1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Leu295) of human SULT1A1 (Accession #NP_001046.2) fused with a 6×His Tag at the C-terminus. |
≥90% as determined by SDS-PAGE | |
This protein contains the human SULT1A1(Met1-Leu295) was fused with the N-terminal His Tag and expressed in E. coli. |
Filter by Rating