SULF2 Rabbit Polyclonal Antibody

• Catalog Number: orb330580
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SULF2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SULF2
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 98kDa
• Target: SULF2
• UniProt ID: Q8IWU5
• Protein Sequence: Synthetic peptide located within the following region: DVLNQLHVQLMELRSCKGYKQCNPRTRNMDLGLKDGGSYEQYRQFQRRKW
• NCBI: NP_061325
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti DKFZp313E091 antibody, anti FLJ90554 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Positive control (+): A549 Cell Lysate (N03), Negative control (-): THP1 Cell Lysate (N30), Antibody concentration: 3 ug/ml.

Human kidney

WB Suggested Anti-SULF2 Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate.