You have no items in your shopping cart.
SALF Rabbit Polyclonal Antibody
SKU: orb573830
Description
Research Area
Epigenetics & Chromatin
Images & Validation
−Item 1 of 1
| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SALF |
| Target | STON1-GTF2A1L |
| Protein Sequence | Synthetic peptide located within the following region: NSGDDVSEQDVPDLFDTDNVIVCQYDKIHRSKNKWKFYLKDGVMCFGGRD |
| Molecular Weight | 132kDa |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−ALF, SALF, GTF2A1L, GTF2A1LF
Similar Products
−- Item 1 of 3
STON1 Rabbit Polyclonal Antibody [orb665761]
IF, IHC, WB
Human
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl, 50 μl - Item 1 of 3
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
WB Suggested Anti-SALF Antibody Titration: 5.0 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.
Documents Download
Datasheet
Product Information
Request a Document
SALF Rabbit Polyclonal Antibody (orb573830)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 3-7 working days