STOML2 Rabbit Polyclonal Antibody

• Catalog Number: orb585120
• Category: Antibodies
• Description: Rabbit polyclonal antibody to STOML2
• Target: STOML2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: VTSMVAQAMGVYGALTKAPVPGTPDSLSSGSSRDVQGTDASLDEELDRVK
• UniProt ID: Q9UJZ1
• MW: 39kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: SLP-2, HSPC108
• Research Area: Cell Biology, Molecular Biology
• Note: For research use only
• NCBI: NP_038470

Sample Type: Human 293T, Antibody dilution: 1.0 ug/ml. STOML2 is supported by BioGPS gene expression data to be expressed in HEK293T.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-STOML2 Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell. STOML2 is supported by BioGPS gene expression data to be expressed in 721_B.