You have no items in your shopping cart.
Cart summary
Item 1 of 1
STN1 Rabbit Polyclonal Antibody
Catalog Number: orb585375
Product Properties
| Catalog Number | orb585375 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to STN1 |
| Target | STN1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Protein Sequence | Synthetic peptide located within the following region: DKDLHRKIHRIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQ |
| UniProt ID | Q9H668 |
| MW | 40kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | AAF44, OBFC1, AAF-44, RPA-32, bA541N10.2 |
| Research Area | Cancer Biology, Cell Biology, Epigenetics & Chroma Read more... |
| Note | For research use only |
| NCBI | NP_079204 |
Images
WB Suggested Anti-OBFC1 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Heart.
Similar Products
- Item 1 of 3
Stonin-1 rabbit pAb [orb767460]
ELISA, IF, IHC-P, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
50 μl, 100 μl - Item 1 of 3
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
Reviews
STN1 Rabbit Polyclonal Antibody (orb585375)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review