STK4 monoclonal antibody (M01), clone 1D7-8A10

• Catalog Number: orb2292112
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant STK4.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: STK4 (AAH05231, 1 a.a. ~ 39 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEG
• Tested applications: ELISA, IF, IHC-P, WB
• Clone Number: 1D7-8A10
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH05231

Detection limit for recombinant GST tagged STK4 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to STK4 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to STK4 on formalin-fixed paraffin-embedded human stomach carcinoma tissue. [antibody concentration 5 ug/ml]

STK4 monoclonal antibody (M01), clone 1D7-8A10 Western Blot analysis of STK4 expression in Hela S3 NE.

Western Blot detection against Immunogen (30.03 KDa).