You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292112 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant STK4. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | STK4 (AAH05231, 1 a.a. ~ 39 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEG |
Tested applications | ELISA, IF, IHC-P, WB |
Clone Number | 1D7-8A10 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH05231 |
Detection limit for recombinant GST tagged STK4 is approximately 0.03 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to STK4 on HeLa cell. [antibody concentration 10 ug/ml]
Immunoperoxidase of monoclonal antibody to STK4 on formalin-fixed paraffin-embedded human stomach carcinoma tissue. [antibody concentration 5 ug/ml]
STK4 monoclonal antibody (M01), clone 1D7-8A10 Western Blot analysis of STK4 expression in Hela S3 NE.
Western Blot detection against Immunogen (30.03 KDa).