STK19 Rabbit Polyclonal Antibody

• Catalog Number: orb586276
• Category: Antibodies
• Description: Rabbit polyclonal antibody to STK19
• Target: STK19
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Porcine, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human STK19
• Protein Sequence: Synthetic peptide located within the following region: PPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAHGIIFTE
• UniProt ID: P49842
• MW: 41kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: G11, RP1, D6S60, D6S60E, HLA-RP1
• Research Area: Epigenetics & Chromatin, Protein Biochemistry
• Note: For research use only
• NCBI: NP_115830

WB Suggested Anti-STK19 Antibody, Titration: 1.0 ug/ml, Positive Control: 293T Whole Cell. STK19 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.