You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb308855 |
---|---|
Category | Antibodies |
Description | Stathmin 1/STMN1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Predicted Reactivity | Bovine |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Stathmin 1 (2-34aa ASSDIQVKELEKRASGQAFELILSPRSKESVPE), different from the related mouse sequence by one amino acid, and identical to the related rat sequence. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human, Mouse, Rat |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 17303 MW |
UniProt ID | P16949 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Stathmin;Leukemia-associated phosphoprotein p18;Me Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of THP-1 cells using anti-Stathmin 1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of RAW264.7 cells using anti-Stathmin 1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of RH-35 cells using anti-Stathmin 1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of Stathmin 1 using anti-Stathmin 1 antibody.Lane 1:rat brain tissue;2:rat testis tissue;3:mouse brain tissue;4:mouse testis tissue; 5:human MDA-MB-453 cell; 6:human SH-SY5Y cell;6:human Raji cell.
IF analysis of Stathmin 1 using anti-Stathmin 1 antibody. Stathmin 1 was detected in immunocytochemical section of MCF7 cells.
IHC analysis of Stathmin 1 using anti-Stathmin 1 antibody. Stathmin 1 was detected in paraffin-embedded section of human placenta tissue.
IHC analysis of Stathmin 1 using anti-Stathmin 1 antibody. Stathmin 1 was detected in paraffin-embedded section of human intestinal cancer tissue.
IHC analysis of Stathmin 1 using anti-Stathmin 1 antibody. Stathmin 1 was detected in paraffin-embedded section of mouse brain tissue.
IHC analysis of Stathmin 1 using anti-Stathmin 1 antibody. Stathmin 1 was detected in paraffin-embedded section of rat brain tissue.
FC, ICC, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Monoclonal | |
Unconjugated |
Filter by Rating