Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Stat1 Rabbit Polyclonal Antibody

SKU: orb576165

Description

Stat1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Stat1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of Rat Stat1. This antibody reacts with Rat samples and is predicted to react with Canine, Equine, Guinea pig, Human, Mouse, Rabbit. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Infectious Disease & Virology

Images & Validation

Tested ApplicationsWB
ReactivityRat
Predicted ReactivityCanine, Equine, Guinea pig, Human, Mouse, Rabbit

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Rat Stat1
TargetStat1
Protein SequenceSynthetic peptide located within the following region: DQVMCIEHEIKTLEDLQDEYDFKCKTSQNRESEANGVAKSDQKQEQLLLH
Molecular Weight82kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

DD6G4-4

Similar Products

  • STAT1 Rabbit Polyclonal Antibody [orb158504]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Porcine, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • STAT1 Antibody (C-term) [orb1932073]

    FC,  IF,  IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Stat1 (phospho Ser727) rabbit pAb Antibody [orb770169]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Stat1 rabbit pAb Antibody [orb766382]

    ELISA,  IF,  IHC,  IP,  WB

    Gallus, Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
  • Stat1 (phospho Tyr701) rabbit pAb Antibody [orb764279]

    ELISA,  IF,  IHC,  IP,  WB

    Human, Monkey, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Stat1 Rabbit Polyclonal Antibody

Sample Type: Rat Pancreas lysates, Antibody Dilution: 1.0 ug/ml.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_116001

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Stat1 Rabbit Polyclonal Antibody (orb576165)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry