STARD7 Rabbit Polyclonal Antibody

• Catalog Number: orb586426
• Category: Antibodies
• Description: Rabbit polyclonal antibody to STARD7
• Target: STARD7
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Porcine
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human STARD7
• Protein Sequence: Synthetic peptide located within the following region: SINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVMDK
• UniProt ID: Q9NQZ5
• MW: 37kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: GTT1, FAME2
• Research Area: Signal Transduction
• Note: For research use only
• NCBI: NP_064536

WB Suggested Anti-STARD7 Antibody, Titration: 1.0 ug/ml, Positive Control: HT1080 Whole Cell.