STAP1 Rabbit Polyclonal Antibody

SKU: orb326607

Description

Rabbit polyclonal antibody to STAP1

Research Area

Immunology & Inflammation, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Equine, Rabbit, Yeast

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human STAP1
• Target: STAP1
• Protein Sequence: Synthetic peptide located within the following region: TELSVPQNVSLLPGQVIKLHEVLEREKKRRIETEQSTSVEKEKEPTEDYV
• Molecular Weight: 32kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti BRDG1 antibody, anti STAP-1 antibody

WB Suggested Anti-STAP1 Antibody, Titration: 1.0 ug/mL, Positive Control: HCT15 Whole Cell.

Quick Database Links

Gene Symbol

STAP1

UniProt

Q9ULZ2

RefSeq (Protein):NP_036240