ST6GALNAC5 Rabbit Polyclonal Antibody

SKU: orb325533

Description

ST6GALNAC5 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of ST6GALNAC5. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human ST6GALNAC5. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ST6GALNAC5
• Target: ST6GALNAC5
• Protein Sequence: Synthetic peptide located within the following region: AFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTIALELCDRINV
• Molecular Weight: 38 kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti MGC3184 antibody, anti SIAT7E antibody, anti ST6GalNAcV antibody

Quick Database Links

Gene Symbol

ST6GALNAC5

UniProt

Q9BVH7

RefSeq (Protein):NP_112227