ST6GALNAC2 Rabbit Polyclonal Antibody

SKU: orb582169

Description

Rabbit polyclonal antibody to ST6GALNAC2

Research Area

Cell Biology, Protein Biochemistry, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ST6GALNAC2
• Target: ST6GALNAC2
• Protein Sequence: Synthetic peptide located within the following region: VNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVP
• Molecular Weight: 42 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

STHM, SIAT7, SAITL1, SIAT7B, SIATL1, ST6GalNAII

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. Peptide is present in isoforms of 47 kDa, 42 kDa and 24 kDa. Protein may be glycolsylated.

WB Suggested Anti-ST6GALNAC2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human heart.

Quick Database Links

Gene Symbol

ST6GALNAC2

UniProt

Q9UJ37

RefSeq (Protein):NP_006447