ST6GALNAC2 Rabbit Polyclonal Antibody

• Catalog Number: orb582169
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ST6GALNAC2
• Target: ST6GALNAC2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ST6GALNAC2
• Protein Sequence: Synthetic peptide located within the following region: VNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVP
• UniProt ID: Q9UJ37
• MW: 42 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: STHM, SIAT7, SAITL1, SIAT7B, SIATL1, ST6GalNAII
• Research Area: Cell Biology, Protein Biochemistry, Signal Transdu
• Note: For research use only
• NCBI: NP_006447

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. Peptide is present in isoforms of 47 kDa, 42 kDa and 24 kDa. Protein may be glycolsylated.

WB Suggested Anti-ST6GALNAC2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human heart.