You have no items in your shopping cart.
Cart summary
Item 1 of 1
SSX2 Rabbit Polyclonal Antibody
Catalog Number: orb581421
| Catalog Number | orb581421 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SSX2 |
| Target | SSX2 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human SSX2 |
| Protein Sequence | Synthetic peptide located within the following region: NDSEEVPEASGPQNDGKELCPPGKPTTS' target='_blank'>TFGRLQGISPKIMPKKPAEEGNDSEEVPEASGPQNDGKELCPPGKPTTS |
| UniProt ID | Q16385 |
| MW | 24kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | SSX, HD21, CT5.2, CT5.2A, HOM-MEL-40 |
| Note | For research use only |
| NCBI | NP_783629 |
Sample Type: Lung Tumor lysates, Antibody dilution: 1.0 ug/ml.
- Item 1 of 3
- Item 1 of 2
- Item 1 of 2
- Item 1 of 2
- Item 1 of 1
