SSTR1 Rabbit Polyclonal Antibody

SKU: orb584377

Description

Rabbit polyclonal antibody to SSTR1

Research Area

Pharmacology & Drug Discovery, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SSTR1
• Target: SSTR1
• Protein Sequence: Synthetic peptide located within the following region: RMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD
• Molecular Weight: 43kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

SS1R, SS1-R, SRIF-2, SS-1-R

Immunohistochemistry with Pancreas tissue at an antibody concentration of 5 ug/ml using anti-SSTR1 antibody (orb584377).

WB Suggested Anti-SSTR1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: THP-1 cell lysate.

Quick Database Links

Gene Symbol

SSTR1

UniProt

P28646

RefSeq (Protein):NP_001040