SRP54 Rabbit Polyclonal Antibody

SKU: orb330132

Description

Rabbit polyclonal antibody to SRP54

Research Area

Cell Biology, Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SRP54
• Target: SRP54
• Protein Sequence: Synthetic peptide located within the following region: ENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEA
• Molecular Weight: 56kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

SCN8

Hum. Adult Placenta.

Positive control (+): MCF7 (N10), Negative control (-): 293T (2T), Antibody concentration: 1 ug/mL.

SRP54 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb330132 with 1:200 dilution. Western blot was performed using orb330132 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: SRP54 IP with orb330132 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

WB Suggested Anti-SRP54 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Placenta.

Quick Database Links

Gene Symbol

SRP54

UniProt

P61011

RefSeq (Protein):NP_003127